Posts

Showing posts from 2020

Batwoman Ringtone cct cgg cgg gca

Image
The T I dedicate this ringtone to "Batwoman" Dr. Shi Zhengli (Wuhan Institute of Virology -WIV) and Dr. Ralph Baric (UNC-Chapel Hill) who worked with Chinese horseshoe bats and published research on synthetic/chimeric coronaviruses. Their work most likely led to the outbreak whether intentionally or accidentally.  Update as of 9 May:  Dr. Shi Zhengli has not been seen in public for 2 days. I hope she is safe because we need her - she or someone in her lab may have opened the proverbial Pandora's Box, but we need her expertise in finding some type of therapeutic solution.  The WIV was partially funded with USD $7.4M (2018/19) with Dr. Fauci heading the approval for the gain of function (GOF) project for the potential pandemic pathogens (PPP) program. The GOF PPP program was banned in October of 2013 for obvious reasons of bio-ethics. Why is was reinstated in 2017 is a good question.  Dr. Shi Zhengli has stated, "she swears on her life she did not manipulate the virus...

"Prelude in S" PRRA - The "smoking gun" of genetic manipulation in the S gene

Image
Listen to the amino acid sequence of the S gene. At the insertion site of prra, there will be a different sound - try to see if you can hear the difference. Click here to listen MP3 file of prra insertion (It is at 1:42) Image Source: Nature Image of the comparison of the SARS-CoV-2 Human virus with other Corona Viruses (Published in Nature on March 17, 2020) The PRRA sequence 681-684 is the site where the SARS-CoV-2 sequence is noticeably different than the other CoV samples where it is simply naturally missing (see red circle). Take a look below at the yellow highlighted  prra . This is a polybasic furin cleavage insert that is lab manipulated! (where p = proline, r = arginine, a = alanine) The below image is from the Antiviral Research 176 (2020) GenBank amino acid sequence 1 mfvflvllpl vssqcvnltt rtqlppaytn sftrgvyypd kvfrssvlhs tqdlflpffs 61 nvtwfhaihv sgtngtkrfd npvlpfndgv yfasteksni irgwifgttl dsktqslliv 121 nnatnv...

M Gene Artwonk 3Biovoice

Image
M Gene Artwonk 3 Biovoice mp3 created with Artwonk freeware An incredible piece of software developed by the late John Dunn and his geneticist wife Dr. Mary Anne Clark

M Gene Sheet Music in C Major

Image
aa sequence  (222 aa = 222 notes) 1 madsngtitv eelkklleqw nlvigflflt wicllqfaya nrnrflyiik liflwllwpv 61 tlacfvlaav yrinwitggi aiamaclvgl mwlsyfiasf rlfartrsmw sfnpetnill 121 nvplhgtilt rplleselvi gavilrghlr iaghhlgrcd ikdlpkeitv atsrtlsyyk 181 lgasqrvagd sgfaaysryr ignyklntdh ssssdniall vq

E Gene Sheet Music

Image
E GENE The notes are arranged in C Major scale (see chart below) aa sequence  (75 aa = 75 musical notes) 1 mysfvseetg tlivnsvllf lafvvfllvt lailtalrlc ayccnivnvs lvkpsfyvys 61 rvknlnssrv pdllv E Gene of the SARS-CoV-2 Virus 18 March 2020 C Major musical Scale used to create this sheet music (Bio2MIDI freeware)

ORF1ab gene - Fantasia

ORF 1ab gene - Melodic Tom ORF 1ab gene - Fantasia mp3 slow ORF1ab gene - Fantasia mp3  fast Open Reading Frame 1ab gene Source ORF1ab created with Bio2MIDI freeware aa sequence 1 meslvpgfne kthvqlslpv lqvrdvlvrg fgdsveevls earqhlkdgt cglvevekgv 61 lpqleqpyvf ikrsdartap hghvmvelva elegiqygrs getlgvlvph vgeipvayrk 121 vllrkngnkg agghsygadl ksfdlgdelg tdpyedfqen wntkhssgvt relmrelngg 181 aytryvdnnf cgpdgyplec ikdllaragk asctlseqld fidtkrgvyc creheheiaw 241 yterseksye lqtpfeikla kkfdtfngec pnfvfplnsi iktiqprvek kkldgfmgri 301 rsvypvaspn ecnqmclstl mkcdhcgets wqtgdfvkat cefcgtenlt kegattcgyl 361 pqnavvkiyc pachnsevgp ehslaeyhne sglktilrkg grtiafggcv fsyvgchnkc 421 aywvprasan igcnhtgvvg egseglndnl leilqkekvn inivgdfkln eeiaiilasf 481 sastsafvet vkgldykafk qivescgnfk vtkgkakkga wnigeqksil splyafasea 541 arvvrsifsr tletaqnsvr vlqkaaitil dgisqyslrl idammftsdl atnnlvvmay 601 itggvvqlts qwltnifgtv yeklkp...

ORF3a gene - Space Voice

ORF3a - Space Voice mp3 Open Reading Frame 3a gene Source ORF3a created with Bio2MIDI freeware aa sequence 1 mdlfmrifti gtvtlkqgei kdatpsdfvr atatipiqas lpfgwlivgv allavfqsas 61 kiitlkkrwq lalskgvhfv cnllllfvtv yshlllvaag leapflylya lvyflqsinf 121 vriimrlwlc wkcrsknpll ydanyflcwh tncydycipy nsvtssivit sgdgttspis 181 ehdyqiggyt ekwesgvkdc vvlhsyftsd yyqlystqls tdtgvehvtf fiynkivdep 241 eehvqihtid gssgvvnpvm epiydepttt tsvpl

ORF6 - Voice Oohs

ORF6 - Voice Oohs mp3 Open Reading Frame 6 protein Source ORF6 created with Bio2MIDI freeware aa sequence 1 mfhlvdfqvt iaeilliimr tfkvsiwnld yiinliiknl sksltenkys qldeeqpmei 61 d

ORF7a - Violin

ORF7a - Violin mp3 Open Reading Frame 7a protein Amino Acid Sequence Source:  ORF7a Created with Bio2MIDI freeware aa sequence 1 mkiilflali tlatcelyhy qecvrgttvl lkepcssgty egnspfhpla dnkfaltcfs 61 tqfafacpdg vkhvyqlrar svspklfirq eevqelyspi flivaaivfi tlcftlkrkt 121 e

ORF8 Gene - glockenspiel

ORF8 Gene - Glockenspiel mp3 Open Reading Frame 8 Amino Acid Sequence Source:  GenBank: MN908947.3 Created with Bio2MIDI freeware ORF8 Link 1 mkflvflgii ttvaafhqec slqsctqhqp yvvddpcpih fyskwyirvg arksapliel 61 cvdeagsksp iqyidignyt vsclpftinc qepklgslvv rcsfyedfle yhdvrvvldf 121 i

ORF10 Gene - Bowed Glass

Image
ORF10 Gene - Bowed Glass Listen here ORF10 Gene mp3 Open Reading Frame 10 Gene  Amino Acid Sequence Source: GenBank: MN908947.3 (created using Bio2MIDI freeware) MGYINVFAFPFTIYSLLLCRMNSRNYIAQVDVVNFNLT Open Reading Frame (ORF) If you are musically inclined, you know about triplets. Well triplets are like codons, which are 3 bases (see the example below of GAU in the mRNA)

N Gene - Brightness

Image
Listen by clicking below N gene - brightness N ( nucleocapsid phosphoprotein) Gene  Amino Acid Sequence  Source: GenBank: MN908947.3 (created using Bio2MIDI freeware) MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQG LPNNTASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMK DLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQ LPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAA LALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGR RGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYT GAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTV TLLPAADLDDFSKQLQQSMSSADSTQA See the chart below to identify the single letter amino acids (shown in red circles).

S Gene - Synth Strings1

Image
This is the gene that was manipulated with a gene insert probably in the GOF (Gain of Function) research by the US-funded (headed by Dr. Fauci) PPP (potential pandemic pathogen) program at the Wuhan Virology lab in China. It is also the focus of vaccine manufacturers. The spike attaches to the ACE-2 receptors found throughout the human body including the lungs, kidneys, stomach, intestines and blood vessels. It has an insert of a polybasic furin cleavage not found in nature. Take a look at the yellow highlighted prra . This is a polybasic furin cleavage insert that is lab manipulated! (where p = proline, r = arginine, a = alanine) Listen by clicking the mp3 file below S gene synth strings 1 Spike glycoprotein Amino Acid Sequence (1,273 aa) Source: GenBank: MN908947.3 (created using Bio2MIDI freeware) 1 mfvflvllpl vssqcvnltt rtqlppaytn sftrgvyypd kvfrssvlhs tqdlflpffs 61 nvtwfhaihv sgtngtkrfd npvlpfndgv yfasteksni irgwifgttl dsktqslliv 121 nna...

M Gene - Harp

Image
From this aa sequence 1 madsngtitv eelkklleqw nlvigflflt wicllqfaya nrnrflyiik liflwllwpv 61 tlacfvlaav yrinwitggi aiamaclvgl mwlsyfiasf rlfartrsmw sfnpetnill 121 nvplhgtilt rplleselvi gavilrghlr iaghhlgrcd ikdlpkeitv atsrtlsyyk 181 lgasqrvagd sgfaaysryr ignyklntdh ssssdniall vq to this sheet music below Listen to this aa sequence by clicking below M gene harp Membrane glycoprotein Amino Acid Sequence Source: GenBank: MN908947.3 (created using Bio2MIDI freeware) MADSNGTITVEELKKLLEQWNLVIGFLFLTWICLLQFAYANRNR FLYIIKLIFLWLLWPVTLACFVLAAVYRINWITGGIAIAMACLVGLMWLSYFIASFRL FARTRSMWSFNPETNILLNVPLHGTILTRPLLESELVIGAVILRGHLRIAGHHLGRCD IKDLPKEITVATSRTLSYYKLGASQRVAGDSGFAAYSRYRIGNYKLNTDHSSSSDNIA LLVQ The single letter amino acid codes are shown in red circles in the chart below. From ScienceDirect: Matrix Proteins The term...

E Gene - steel drums

Image
Listen by clicking below E Gene in mp3 format E gene (envelope gene - a structural protein located in the envelope or shell of the virus) Envelope protein amino acid sequence Source: GenBank: MN908947.3 (created using Bio2MIDI freeware) MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV The single letter amino acid codes are shown in red circles in the chart below.