ORF10 Gene - Bowed Glass

ORF10 Gene - Bowed Glass


Open Reading Frame 10 Gene 
Amino Acid Sequence
Source: GenBank: MN908947.3
(created using Bio2MIDI freeware)

                          MGYINVFAFPFTIYSLLLCRMNSRNYIAQVDVVNFNLT


Open Reading Frame (ORF)
If you are musically inclined, you know about triplets. Well triplets are like codons, which are 3 bases (see the example below of GAU in the mRNA)


Comments

Popular posts from this blog

"Prelude in S" PRRA - The "smoking gun" of genetic manipulation in the S gene

Batwoman Ringtone cct cgg cgg gca

ORF1ab gene - Fantasia