ORF10 Gene - Bowed Glass
ORF10 Gene - Bowed Glass
Open Reading Frame 10 Gene
Amino Acid Sequence
Source: GenBank: MN908947.3
(created using Bio2MIDI freeware)
MGYINVFAFPFTIYSLLLCRMNSRNYIAQVDVVNFNLT
Open Reading Frame (ORF)
If you are musically inclined, you know about triplets. Well triplets are like codons, which are 3 bases (see the example below of GAU in the mRNA)
Comments
Post a Comment