N Gene - Brightness



Listen by clicking below
N gene - brightness

N (nucleocapsid phosphoprotein) Gene 
Amino Acid Sequence 

Source: GenBank: MN908947.3

(created using Bio2MIDI freeware)




                     MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQG
                     LPNNTASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMK
                     DLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQ
                     LPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAA
                     LALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGR
                     RGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYT
                     GAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTV
                     TLLPAADLDDFSKQLQQSMSSADSTQA


See the chart below to identify the single letter amino acids (shown in red circles).


Comments

Post a Comment

Popular posts from this blog

Batwoman Ringtone cct cgg cgg gca

Image
The T I dedicate this ringtone to "Batwoman" Dr. Shi Zhengli (Wuhan Institute of Virology -WIV) and Dr. Ralph Baric (UNC-Chapel Hill) who worked with Chinese horseshoe bats and published research on synthetic/chimeric coronaviruses. Their work most likely led to the outbreak whether intentionally or accidentally.  Update as of 9 May:  Dr. Shi Zhengli has not been seen in public for 2 days. I hope she is safe because we need her - she or someone in her lab may have opened the proverbial Pandora's Box, but we need her expertise in finding some type of therapeutic solution.  The WIV was partially funded with USD $7.4M (2018/19) with Dr. Fauci heading the approval for the gain of function (GOF) project for the potential pandemic pathogens (PPP) program. The GOF PPP program was banned in October of 2013 for obvious reasons of bio-ethics. Why is was reinstated in 2017 is a good question.  Dr. Shi Zhengli has stated, "she swears on her life she did not manipulate the virus...
Read more

"Prelude in S" PRRA - The "smoking gun" of genetic manipulation in the S gene

Image
Listen to the amino acid sequence of the S gene. At the insertion site of prra, there will be a different sound - try to see if you can hear the difference. Click here to listen MP3 file of prra insertion (It is at 1:42) Image Source: Nature Image of the comparison of the SARS-CoV-2 Human virus with other Corona Viruses (Published in Nature on March 17, 2020) The PRRA sequence 681-684 is the site where the SARS-CoV-2 sequence is noticeably different than the other CoV samples where it is simply naturally missing (see red circle). Take a look below at the yellow highlighted  prra . This is a polybasic furin cleavage insert that is lab manipulated! (where p = proline, r = arginine, a = alanine) The below image is from the Antiviral Research 176 (2020) GenBank amino acid sequence 1 mfvflvllpl vssqcvnltt rtqlppaytn sftrgvyypd kvfrssvlhs tqdlflpffs 61 nvtwfhaihv sgtngtkrfd npvlpfndgv yfasteksni irgwifgttl dsktqslliv 121 nnatnv...
Read more

ORF3a gene - Space Voice

ORF3a - Space Voice mp3 Open Reading Frame 3a gene Source ORF3a created with Bio2MIDI freeware aa sequence 1 mdlfmrifti gtvtlkqgei kdatpsdfvr atatipiqas lpfgwlivgv allavfqsas 61 kiitlkkrwq lalskgvhfv cnllllfvtv yshlllvaag leapflylya lvyflqsinf 121 vriimrlwlc wkcrsknpll ydanyflcwh tncydycipy nsvtssivit sgdgttspis 181 ehdyqiggyt ekwesgvkdc vvlhsyftsd yyqlystqls tdtgvehvtf fiynkivdep 241 eehvqihtid gssgvvnpvm epiydepttt tsvpl
Read more