M Gene - Harp 





From this aa sequence 
        1 madsngtitv eelkklleqw nlvigflflt wicllqfaya nrnrflyiik liflwllwpv
       61 tlacfvlaav yrinwitggi aiamaclvgl mwlsyfiasf rlfartrsmw sfnpetnill
      121 nvplhgtilt rplleselvi gavilrghlr iaghhlgrcd ikdlpkeitv atsrtlsyyk
      181 lgasqrvagd sgfaaysryr ignyklntdh ssssdniall vq


to this sheet music below




Listen to this aa sequence by clicking below
M gene harp 


Membrane glycoprotein  
Amino Acid Sequence
Source: GenBank: MN908947.3

(created using Bio2MIDI freeware)








                          MADSNGTITVEELKKLLEQWNLVIGFLFLTWICLLQFAYANRNR
                     FLYIIKLIFLWLLWPVTLACFVLAAVYRINWITGGIAIAMACLVGLMWLSYFIASFRL
                     FARTRSMWSFNPETNILLNVPLHGTILTRPLLESELVIGAVILRGHLRIAGHHLGRCD
                     IKDLPKEITVATSRTLSYYKLGASQRVAGDSGFAAYSRYRIGNYKLNTDHSSSSDNIA
                     LLVQ


The single letter amino acid codes are shown in red circles in the chart below.










From ScienceDirect:  

Matrix Proteins
The term matrix protein is used to describe a protein that forms layer on the inside of the viral envelope. ... Additional M is found at the plasma membrane where it associates with the cytoplasmic domains of influenza virus envelope glycoproteins. Thus M organizes both glycoproteins and the nucleocapsids.













































Comments











Post a Comment























Popular posts from this blog









"Prelude in S"  PRRA - The "smoking gun" of genetic manipulation in the S gene




















Image







Listen to the amino acid sequence of the S gene. At the insertion site of prra, there will be a different sound - try to see if you can hear the difference.    Click here to listen  MP3 file of prra insertion  (It is at 1:42)      Image Source: Nature  Image of the comparison of the SARS-CoV-2 Human virus with other Corona Viruses (Published in Nature on March 17, 2020)              The PRRA sequence 681-684 is the site where the SARS-CoV-2 sequence is noticeably different than the other CoV samples where it is simply naturally missing (see red circle). Take a look below at the yellow highlighted  prra . This is a polybasic furin cleavage insert that is lab manipulated! (where p = proline, r = arginine, a = alanine) The below image is from the Antiviral Research 176 (2020)     GenBank amino acid sequence                   1 mfvflvllpl vssqcvnltt rtqlppaytn sftrgvyypd kvfrssvlhs tqdlflpffs         61 nvtwfhaihv sgtngtkrfd npvlpfndgv yfasteksni irgwifgttl dsktqslliv        121 nnatnv...








Read more










Batwoman Ringtone  cct cgg cgg gca 




















Image







The T I dedicate this ringtone to "Batwoman" Dr. Shi Zhengli (Wuhan Institute of Virology -WIV) and Dr. Ralph Baric (UNC-Chapel Hill)  who worked with Chinese horseshoe bats and published research on synthetic/chimeric coronaviruses. Their work most likely led to the outbreak whether intentionally or accidentally.  Update as of 9 May:  Dr. Shi Zhengli has not been seen in public for 2 days. I hope she is safe because we need her - she or someone in her lab may have opened the proverbial Pandora's Box, but we need her expertise in finding some type of therapeutic solution.  The WIV was partially funded with USD $7.4M (2018/19) with Dr. Fauci heading the approval for the gain of function (GOF) project for the potential pandemic pathogens (PPP) program. The GOF PPP program was banned in October of 2013 for obvious reasons of bio-ethics. Why is was reinstated in 2017 is a good question.  Dr. Shi Zhengli has stated, "she swears on her life she did not manipulate the virus...








Read more










N Gene - Brightness 




















Image







        Listen by clicking below  N gene - brightness    N ( nucleocapsid phosphoprotein) Gene    Amino Acid Sequence     Source: GenBank: MN908947.3    (created using Bio2MIDI freeware)                                    MSDNGPQNQRNAPRITFGGPSDSTGSNQNGERSGARSKQRRPQG                      LPNNTASWFTALTQHGKEDLKFPRGQGVPINTNSSPDDQIGYYRRATRRIRGGDGKMK                      DLSPRWYFYYLGTGPEAGLPYGANKDGIIWVATEGALNTPKDHIGTRNPANNAAIVLQ                      LPQGTTLPKGFYAEGSRGGSQASSRSSSRSRNSSRNSTPGSSRGTSPARMAGNGGDAA                      LALLLLDRLNQLESKMSGKGQQQQGQTVTKKSAAEASKKPRQKRTATKAYNVTQAFGR                      RGPEQTQGNFGDQELIRQGTDYKHWPQIAQFAPSASAFFGMSRIGMEVTPSGTWLTYT                      GAIKLDDKDPNFKDQVILLNKHIDAYKTFPPTEPKKDKKKKADETQALPQRQKKQQTV                      TLLPAADLDDFSKQLQQSMSSADSTQA    See the chart below to identify the single letter amino acids (shown in red circles).         








Read more