E Gene - steel drums


Listen by clicking below
E Gene in mp3 format

E gene (envelope gene - a structural protein located in the envelope or shell of the virus)

Envelope protein amino acid sequence
Source: GenBank: MN908947.3
(created using Bio2MIDI freeware)


MYSFVSEETGTLIVNSVLLFLAFVVFLLVTLAILTALRLCAYCCNIVNVSLVKPSFYVYSRVKNLNSSRVPDLLV





The single letter amino acid codes are shown in red circles in the chart below.



Comments

Popular posts from this blog

"Prelude in S" PRRA - The "smoking gun" of genetic manipulation in the S gene

Batwoman Ringtone cct cgg cgg gca

S Gene - Synth Strings1